Anti-CC2D2B
Artikelnummer:
ATA-HPA044091
- Bilder (6)
| Artikelname: | Anti-CC2D2B |
| Artikelnummer: | ATA-HPA044091 |
| Hersteller Artikelnummer: | HPA044091 |
| Alternativnummer: | ATA-HPA044091-100,ATA-HPA044091-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | bA248J23.4, C10orf130 |
| coiled-coil and C2 domain containing 2B |
| Anti-CC2D2B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 387707 |
| UniProt: | None |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VPSSSPVVNQRKLPKDMMPRILEDEGFYIQRKPEIYKKTCNKMENRLLKLEEGKCWFGESGEIMSLPTPIKQSWNF |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CC2D2B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human testis and liver tissues using Anti-CC2D2B antibody. Corresponding CC2D2B RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
HPA044091-100ul |
|
|
HPA044091-100ul |
|
|
HPA044091-100ul |
Produktgarantie und fachkundiger Support
