Anti-TIGAR
Artikelnummer:
ATA-HPA044111
- Bilder (7)
| Artikelname: | Anti-TIGAR |
| Artikelnummer: | ATA-HPA044111 |
| Hersteller Artikelnummer: | HPA044111 |
| Alternativnummer: | ATA-HPA044111-100,ATA-HPA044111-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C12orf5 |
| TP53 induced glycolysis regulatory phosphatase |
| Anti-TIGAR |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 57103 |
| UniProt: | Q9NQ88 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLNNVKFTHAFSSDLMRTKQTMHGILERSKFCKDMTVKYDSRLRERKYGV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TIGAR |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human tonsil shows weak to moderate cytoplasmic positivity in germinal center cells. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
HPA044111-100ul |
|
|
HPA044111-100ul |
|
|
HPA044111-100ul |
Produktgarantie und fachkundiger Support
