Anti-TNP1

Artikelnummer: ATA-HPA044387
Artikelname: Anti-TNP1
Artikelnummer: ATA-HPA044387
Hersteller Artikelnummer: HPA044387
Alternativnummer: ATA-HPA044387-100,ATA-HPA044387-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: TNP1
transition protein 1 (during histone to protamine replacement)
Anti-TNP1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 7141
UniProt: P09430
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: STSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TNP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human testis and fallopian tube tissues using Anti-TNP1 antibody. Corresponding TNP1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human fallopian tube shows low expression as expected.
HPA044387-100ul
HPA044387-100ul
HPA044387-100ul