Anti-SPRR3
Artikelnummer:
ATA-HPA044467
- Bilder (6)
| Artikelname: | Anti-SPRR3 |
| Artikelnummer: | ATA-HPA044467 |
| Hersteller Artikelnummer: | HPA044467 |
| Alternativnummer: | ATA-HPA044467-100,ATA-HPA044467-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SPRR3 |
| small proline-rich protein 3 |
| Anti-SPRR3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6707 |
| UniProt: | Q9UBC9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SPRR3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:5000 - 1:10000 |
|
|
Immunohistochemistry analysis in human esophagus and stomach tissues using Anti-SPRR3 antibody. Corresponding SPRR3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human esophagus shows high expression. |
|
|
Immunohistochemical staining of human stomach shows low expression as expected. |
|
|
HPA044467-100ul |
|
|
HPA044467-100ul |
|
|
HPA044467-100ul |
Produktgarantie und fachkundiger Support
