Anti-GSDMD
Artikelnummer:
ATA-HPA044487
- Bilder (6)
| Artikelname: | Anti-GSDMD |
| Artikelnummer: | ATA-HPA044487 |
| Hersteller Artikelnummer: | HPA044487 |
| Alternativnummer: | ATA-HPA044487-100,ATA-HPA044487-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DF5L, FLJ12150, GSDMDC1 |
| gasdermin D |
| Anti-GSDMD |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 79792 |
| UniProt: | P57764 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GDNVYVVTEVLQTQKEVEVTRTHKREGSGRFSLPGATCLQGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GSDMD |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human stomach shows moderate cytoplasmic and membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic and membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human small intestine shows moderate cytoplasmic and membranous positivity in glandular cells. |
|
|
Western blot analysis in human cell lines U2OS and HEK293 using Anti-GSDMD antibody. Corresponding GSDMD RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
HPA044487-100ul |
Produktgarantie und fachkundiger Support
