Anti-DCAF13
Artikelnummer:
ATA-HPA044504
- Bilder (6)
| Artikelname: | Anti-DCAF13 |
| Artikelnummer: | ATA-HPA044504 |
| Hersteller Artikelnummer: | HPA044504 |
| Alternativnummer: | ATA-HPA044504-100,ATA-HPA044504-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DKFZP564O0463, Gm83, HSPC064, WDSOF1 |
| DDB1 and CUL4 associated factor 13 |
| Anti-DCAF13 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 25879 |
| UniProt: | Q9NV06 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GIGTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DCAF13 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line PC-3 shows localization to nucleus, nucleoli & cytosol. |
|
|
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells. |
|
|
|
|
|
HPA044504-100ul |
|
|
HPA044504-100ul |
|
|
HPA044504-100ul |
Produktgarantie und fachkundiger Support
