Anti-TPP1
Artikelnummer:
ATA-HPA044868
- Bilder (9)
| Artikelname: | Anti-TPP1 |
| Artikelnummer: | ATA-HPA044868 |
| Hersteller Artikelnummer: | HPA044868 |
| Alternativnummer: | ATA-HPA044868-100,ATA-HPA044868-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CLN2, SCAR7 |
| tripeptidyl peptidase I |
| Anti-TPP1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1200 |
| UniProt: | O14773 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SSLRQRPEPQVTGTVGLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TPP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human adrenal gland and skeletal muscle tissues using Anti-TPP1 antibody. Corresponding TPP1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human adrenal gland, kidney, skeletal muscle and testis using Anti-TPP1 antibody HPA044868 (A) shows similar protein distribution across tissues to independent antibody HPA037709 (B). |
|
|
Immunohistochemical staining of human adrenal gland shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Immunohistochemical staining of human kidney using Anti-TPP1 antibody HPA044868. |
|
|
Immunohistochemical staining of human testis using Anti-TPP1 antibody HPA044868. |
|
|
HPA044868-100ul |
|
|
HPA044868-100ul |
|
|
HPA044868-100ul |
Produktgarantie und fachkundiger Support
