Anti-MTERF1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA044894
- Bilder (0)
| Artikelname: | Anti-MTERF1 Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA044894 |
| Hersteller Artikelnummer: | HPA044894 |
| Alternativnummer: | ATA-HPA044894-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MTERF |
| Klonalität: | Polyclonal |
| NCBI: | 7978 |
| UniProt: | Q99551 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NAPRTFSNSLDLNKQMVEFLQAAGLSLGHNDPADFVRKIIFKNPFILIQSTKRVKANIEFLRSTFNLNSEELLVLICGPGAEILDLSNDYARRSYANIKEKLFSLGCTEEEVQKFVLSYPDVIFLAE |
| Target-Kategorie: | MTERF1 |
Produktgarantie und fachkundiger Support
