Anti-C2orf72
Artikelnummer:
ATA-HPA044962
- Bilder (6)
| Artikelname: | Anti-C2orf72 |
| Artikelnummer: | ATA-HPA044962 |
| Hersteller Artikelnummer: | HPA044962 |
| Alternativnummer: | ATA-HPA044962-100,ATA-HPA044962-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LOC257407 |
| chromosome 2 open reading frame 72 |
| Anti-C2orf72 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 257407 |
| UniProt: | A6NCS6 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GQPVEGAWERPGLPGLLACFSWGPWSRRKNQDVAACRSSAQEDFQEPEEELPLTAIFPNGDCDDLGRGSKACDGVVHTPAEP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | C2orf72 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus & plasma membrane. |
|
|
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line CACO-2 |
|
|
HPA044962-100ul |
|
|
HPA044962-100ul |
|
|
HPA044962-100ul |
Produktgarantie und fachkundiger Support
