Anti-HMCES

Artikelnummer: ATA-HPA044968
Artikelname: Anti-HMCES
Artikelnummer: ATA-HPA044968
Hersteller Artikelnummer: HPA044968
Alternativnummer: ATA-HPA044968-100,ATA-HPA044968-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C3orf37, DC12, SRAPD1
5-hydroxymethylcytosine (hmC) binding, ES cell-specific
Anti-HMCES
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 56941
UniProt: Q96FZ2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: WRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: HMCES
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-HMCES antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
HPA044968-100ul
HPA044968-100ul
HPA044968-100ul