Anti-CLEC2L
Artikelnummer:
ATA-HPA045050
- Bilder (6)
| Artikelname: | Anti-CLEC2L |
| Artikelnummer: | ATA-HPA045050 |
| Hersteller Artikelnummer: | HPA045050 |
| Alternativnummer: | ATA-HPA045050-100,ATA-HPA045050-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ32986 |
| C-type lectin domain family 2, member L |
| Anti-CLEC2L |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 154790 |
| UniProt: | P0C7M8 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PEDWLLYGRKCYFFSEEPRDWNTGRQYCHTHEAVLAVIQSQKELEFMFKFTRREPWIGLRRVGDEFHWVNGDPFDPDTFTIAGPGECVFVEP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CLEC2L |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-CLEC2L antibody. Corresponding CLEC2L RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
HPA045050-100ul |
|
|
HPA045050-100ul |
|
|
HPA045050-100ul |
Produktgarantie und fachkundiger Support
