Anti-TMEM236
Artikelnummer:
ATA-HPA045096
- Bilder (6)
| Artikelname: | Anti-TMEM236 |
| Artikelnummer: | ATA-HPA045096 |
| Hersteller Artikelnummer: | HPA045096 |
| Alternativnummer: | ATA-HPA045096-100,ATA-HPA045096-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | bA162I21.2, bA16O1.2, FAM23A, FAM23B |
| transmembrane protein 236 |
| Anti-TMEM236 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 653567 |
| UniProt: | Q5W0B7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LRGSQKSSENGHIHSTSLQHIKTVTEQVRQSPENAASPQATNSTQVSQPSGAMTRSQESVFMGPQEPSCDSGILRMMSRRDVRAELFLWSFLLWSD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TMEM236 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human small intestine and liver tissues using Anti-TMEM236 antibody. Corresponding TMEM236 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human small intestine shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
HPA045096-100ul |
|
|
HPA045096-100ul |
|
|
HPA045096-100ul |
Produktgarantie und fachkundiger Support
