Anti-ABCB8
Artikelnummer:
ATA-HPA045187
- Bilder (9)
| Artikelname: | Anti-ABCB8 |
| Artikelnummer: | ATA-HPA045187 |
| Hersteller Artikelnummer: | HPA045187 |
| Alternativnummer: | ATA-HPA045187-100,ATA-HPA045187-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | EST328128, M-ABC1, MABC1 |
| ATP-binding cassette, sub-family B (MDR/TAP), member 8 |
| Anti-ABCB8 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 11194 |
| UniProt: | Q9NUT2 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LFRVGIRGGPFPGRLLPPLRFQTFSAVRYSDGYRSSSLLRAVAHLRSQLWAHLPRAPLAPRWSPSAWCWVGGALLGPMVLSKHPHLCLVALCEAEEAPPASSTPHVVGSRFNWKLFWQFL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ABCB8 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & mitochondria. |
|
|
Immunohistochemical staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells and in a subset of glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows strong nuclear membrane and weak cytoplasmic staining in myocytes. |
|
|
HPA045187-100ul |
|
|
|
|
|
HPA045187-100ul |
|
|
HPA045187-100ul |
Produktgarantie und fachkundiger Support
