Anti-SCRT1
Artikelnummer:
ATA-HPA045265
- Bilder (8)
| Artikelname: | Anti-SCRT1 |
| Artikelnummer: | ATA-HPA045265 |
| Hersteller Artikelnummer: | HPA045265 |
| Alternativnummer: | ATA-HPA045265-100,ATA-HPA045265-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DKFZp547F072, ZNF898 |
| scratch family zinc finger 1 |
| Anti-SCRT1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 83482 |
| UniProt: | Q9BWW7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LHDKGYLSDYVGPSSVYDGDAEAALLKGPSPEPMYAAAVRGELGP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SCRT1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line SH-SY5Y shows localization to nuclear bodies. |
|
|
Immunohistochemical staining of mouse eye, retina shows moderate positivity. |
|
|
Immunohistochemical staining of mouse brain shows moderate to strong nuclear positivity in neuronal cells. |
|
|
Immunohistochemical staining of human tonsil shows no nuclear positivity as expected. |
|
|
HPA045265-100ul |
|
|
|
|
|
HPA045265-100ul |
|
|
HPA045265-100ul |
Produktgarantie und fachkundiger Support
