Anti-STC2
Artikelnummer:
ATA-HPA045372
- Bilder (7)
| Artikelname: | Anti-STC2 |
| Artikelnummer: | ATA-HPA045372 |
| Hersteller Artikelnummer: | HPA045372 |
| Alternativnummer: | ATA-HPA045372-100,ATA-HPA045372-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | STC-2 |
| stanniocalcin 2 |
| Anti-STC2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8614 |
| UniProt: | O76061 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SAIQKPPTAPPERQPQVDRTKLSRAHHGEAGHHLPEPSSRETGRGAKGERGSKSHPNAHARGRVGGLGAQGPSGSSEWEDEQSEYSDIRR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | STC2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum. |
|
|
Immunohistochemical staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells. |
|
|
Western blot analysis in human cell line TD47D. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and STC2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401224). |
|
|
HPA045372-100ul |
|
|
HPA045372-100ul |
|
|
HPA045372-100ul |
Produktgarantie und fachkundiger Support
