Anti-MPND
Artikelnummer:
ATA-HPA045475
- Bilder (7)
| Artikelname: | Anti-MPND |
| Artikelnummer: | ATA-HPA045475 |
| Hersteller Artikelnummer: | HPA045475 |
| Alternativnummer: | ATA-HPA045475-100,ATA-HPA045475-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ14981 |
| MPN domain containing |
| Anti-MPND |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 84954 |
| UniProt: | Q8N594 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FHSHLTRSEVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEEEIYQSLFLRGLSLVGW |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MPND |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human placenta shows strong cytoplasm granular positivity in in trophoblastic cells. |
|
|
Immunohistochemical staining of human cerebellum shows strong cytoplasm granular positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasm granular positivity in neurons. |
|
|
Immunohistochemical staining of human duodenum shows strong cytoplasm granular positivity in glandular cells. |
|
|
HPA045475-100ul |
|
|
HPA045475-100ul |
|
|
HPA045475-100ul |
Produktgarantie und fachkundiger Support
