Anti-KPNA4
Artikelnummer:
ATA-HPA045500
- Bilder (8)
| Artikelname: | Anti-KPNA4 |
| Artikelnummer: | ATA-HPA045500 |
| Hersteller Artikelnummer: | HPA045500 |
| Alternativnummer: | ATA-HPA045500-100,ATA-HPA045500-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IPOA3, MGC12217, MGC26703, QIP1, SRP3 |
| karyopherin alpha 4 (importin alpha 3) |
| Anti-KPNA4 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3840 |
| UniProt: | O00629 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | KPNA4 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nuclear membrane. |
|
|
Immunohistochemical staining of human testis shows strong nuclear and cytoplasmic positivity in cells of seminiferous ducts. |
|
|
Western blot analysis using Anti-KPNA4 antibody HPA045500 (A) shows similar pattern to independent antibody HPA043154 (B). |
|
|
HPA045500-100ul |
|
|
|
|
|
|
|
|
HPA045500-100ul |
|
|
HPA045500-100ul |
Produktgarantie und fachkundiger Support
