Anti-PODXL

Artikelnummer: ATA-HPA045507
Artikelname: Anti-PODXL
Artikelnummer: ATA-HPA045507
Hersteller Artikelnummer: HPA045507
Alternativnummer: ATA-HPA045507-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Gp200, PC, PCLP
podocalyxin-like
Anti-PODXL
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 5420
UniProt: O00592
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTST
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PODXL
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human kidney and liver tissues using Anti-PODXL antibody. Corresponding PODXL RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human kidney shows high expression.
Western blot analysis in control (vector only transfected HEK293T lysate) and PODXL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401657).
HPA045507-100ul
HPA045507-100ul
HPA045507-100ul