Anti-REG1A
Artikelnummer:
ATA-HPA045549
- Bilder (6)
| Artikelname: | Anti-REG1A |
| Artikelnummer: | ATA-HPA045549 |
| Hersteller Artikelnummer: | HPA045549 |
| Alternativnummer: | ATA-HPA045549-100,ATA-HPA045549-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PSP, PSPS, PSPS1, PTP, REG |
| regenerating islet-derived 1 alpha |
| Anti-REG1A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5967 |
| UniProt: | P05451 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | REG1A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human duodenum shows distinct positivity. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue |
|
|
HPA045549-100ul |
|
|
|
|
|
HPA045549-100ul |
|
|
HPA045549-100ul |
Produktgarantie und fachkundiger Support
