Anti-UBE2L3
Artikelnummer:
ATA-HPA045609
- Bilder (6)
| Artikelname: | Anti-UBE2L3 |
| Artikelnummer: | ATA-HPA045609 |
| Hersteller Artikelnummer: | HPA045609 |
| Alternativnummer: | ATA-HPA045609-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | UBCH7 |
| ubiquitin conjugating enzyme E2 L3 |
| Anti-UBE2L3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 7332 |
| UniProt: | P68036 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | UBE2L3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferus ducts. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA045609-100ul |
|
|
HPA045609-100ul |
|
|
HPA045609-100ul |
Produktgarantie und fachkundiger Support
