Anti-POMC
Artikelnummer:
ATA-HPA046135
- Bilder (8)
| Artikelname: | Anti-POMC |
| Artikelnummer: | ATA-HPA046135 |
| Hersteller Artikelnummer: | HPA046135 |
| Alternativnummer: | ATA-HPA046135-100,ATA-HPA046135-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ACTH, CLIP, LPH, MSH, NPP, POC |
| proopiomelanocortin |
| Anti-POMC |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5443 |
| UniProt: | P01189 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | POMC |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemical staining of human cerebral cortex, liver, pituitary gland and testis using Anti-POMC antibody HPA046135 (A) shows similar protein distribution across tissues to independent antibody HPA063644 (B). |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-POMC antibody HPA046135. |
|
|
Immunohistochemical staining of human pituitary gland using Anti-POMC antibody HPA046135. |
|
|
Immunohistochemical staining of human testis using Anti-POMC antibody HPA046135. |
|
|
Immunohistochemical staining of human liver using Anti-POMC antibody HPA046135. |
|
|
HPA046135-100ul |
|
|
HPA046135-100ul |
|
|
HPA046135-100ul |
Produktgarantie und fachkundiger Support
