Anti-GNG13
Artikelnummer:
ATA-HPA046272
- Bilder (7)
| Artikelname: | Anti-GNG13 |
| Artikelnummer: | ATA-HPA046272 |
| Hersteller Artikelnummer: | HPA046272 |
| Alternativnummer: | ATA-HPA046272-100,ATA-HPA046272-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | G(gamma)13, h2-35 |
| guanine nucleotide binding protein (G protein), gamma 13 |
| Anti-GNG13 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 51764 |
| UniProt: | Q9P2W3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GNG13 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human eye, retina shows moderate membranous positivity in neuronal cells. |
|
|
Immunohistochemical staining of human duodenum shows strong positivity in enteroendocrine cells. |
|
|
Immunohistochemical staining of human cerebellum shows strong positivity in neuronal processes in neuropil. |
|
|
Immunohistochemical staining of human prostate shows no positivity in glandular cells as expected. |
|
|
HPA046272-100ul |
|
|
HPA046272-100ul |
|
|
HPA046272-100ul |
Produktgarantie und fachkundiger Support
