Anti-IGSF11
Artikelnummer:
ATA-HPA046377
- Bilder (6)
| Artikelname: | Anti-IGSF11 |
| Artikelnummer: | ATA-HPA046377 |
| Hersteller Artikelnummer: | HPA046377 |
| Alternativnummer: | ATA-HPA046377-100,ATA-HPA046377-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BT-IgSF, CT119, Igsf13, MGC35227, VSIG3 |
| immunoglobulin superfamily, member 11 |
| Anti-IGSF11 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 152404 |
| UniProt: | Q5DX21 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PPKCSSAKAFHTEISSSDNNTLTSSNAYNSRYWSNNPKVHRNTESVSHFSDLGQSFSFHSGNANIPSIYANGTHLVPGQHKTLVVTANRGSSPQVMSRSNGSVSRKP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | IGSF11 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A549 shows localization to nucleus, cytosol & cell junctions. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts. |
|
|
Western blot analysis in human cell lines SK-MEL-30 and U-251MG using Anti-IGSF11 antibody. Corresponding IGSF11 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1. |
|
|
|
|
|
HPA046377-100ul |
|
|
HPA046377-100ul |
Produktgarantie und fachkundiger Support
