Anti-ZBTB7A
Artikelnummer:
ATA-HPA046387
- Bilder (9)
| Artikelname: | Anti-ZBTB7A |
| Artikelnummer: | ATA-HPA046387 |
| Hersteller Artikelnummer: | HPA046387 |
| Alternativnummer: | ATA-HPA046387-100,ATA-HPA046387-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DKFZp547O146, FBI-1, LRF, pokemon, ZBTB7, ZNF857A |
| zinc finger and BTB domain containing 7A |
| Anti-ZBTB7A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 51341 |
| UniProt: | O95365 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | AVSHVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ZBTB7A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. |
|
|
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-ZBTB7A antibody. Corresponding ZBTB7A RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 |
|
|
HPA046387-100ul |
|
|
|
|
|
HPA046387-100ul |
|
|
HPA046387-100ul |
Produktgarantie und fachkundiger Support
