Anti-FUCA1
Artikelnummer:
ATA-HPA046542
- Bilder (9)
| Artikelname: | Anti-FUCA1 |
| Artikelnummer: | ATA-HPA046542 |
| Hersteller Artikelnummer: | HPA046542 |
| Alternativnummer: | ATA-HPA046542-100,ATA-HPA046542-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FUCA1 |
| fucosidase, alpha-L- 1, tissue |
| Anti-FUCA1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2517 |
| UniProt: | P04066 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VQWEKNTTSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTKITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FUCA1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-FUCA1 antibody. Corresponding FUCA1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, liver, lymph node and skeletal muscle using Anti-FUCA1 antibody HPA046542 (A) shows similar protein distribution across tissues to independent antibody HPA056371 (B). |
|
|
Immunohistochemical staining of human lymph node shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Immunohistochemical staining of human liver using Anti-FUCA1 antibody HPA046542. |
|
|
Immunohistochemical staining of human colon using Anti-FUCA1 antibody HPA046542. |
|
|
HPA046542-100ul |
|
|
HPA046542-100ul |
|
|
HPA046542-100ul |
Produktgarantie und fachkundiger Support
