Anti-CD177

Artikelnummer: ATA-HPA046601
Artikelname: Anti-CD177
Artikelnummer: ATA-HPA046601
Hersteller Artikelnummer: HPA046601
Alternativnummer: ATA-HPA046601-100,ATA-HPA046601-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HNA2A, NB1, PRV1
CD177 molecule
Anti-CD177
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 57126
UniProt: None
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: CQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CD177
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using Anti-CD177 antibody. Corresponding CD177 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human bone marrow shows high expression.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
HPA046601-100ul
HPA046601-100ul
HPA046601-100ul