Anti-UQCRQ
Artikelnummer:
ATA-HPA046693
- Bilder (6)
| Artikelname: | Anti-UQCRQ |
| Artikelnummer: | ATA-HPA046693 |
| Hersteller Artikelnummer: | HPA046693 |
| Alternativnummer: | ATA-HPA046693-100,ATA-HPA046693-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | QCR8, QP-C, UQCR7 |
| ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa |
| Anti-UQCRQ |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 27089 |
| UniProt: | O14949 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | REFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | UQCRQ |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria. |
|
|
Immunohistochemical staining of human gallbladder shows strong cytoplasmic positivity in glandular cells. |
|
|
HPA046693-100ul |
|
|
|
|
|
HPA046693-100ul |
|
|
HPA046693-100ul |
Produktgarantie und fachkundiger Support
