Anti-LRRC73
Artikelnummer:
ATA-HPA046698
- Bilder (8)
| Artikelname: | Anti-LRRC73 |
| Artikelnummer: | ATA-HPA046698 |
| Hersteller Artikelnummer: | HPA046698 |
| Alternativnummer: | ATA-HPA046698-100,ATA-HPA046698-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C6orf154, dJ337H4.2 |
| leucine rich repeat containing 73 |
| Anti-LRRC73 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 221424 |
| UniProt: | Q5JTD7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICRALAGATSLAQLNLNLGVVSSPSRIKQLAEALRTNRSIQSLFLHGS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LRRC73 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol. |
|
|
Immunohistochemistry analysis in human testis and prostate tissues using Anti-LRRC73 antibody. Corresponding LRRC73 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human prostate shows low expression as expected. |
|
|
HPA046698-100ul |
|
|
|
|
|
HPA046698-100ul |
|
|
HPA046698-100ul |
Produktgarantie und fachkundiger Support
