Anti-CLK3

Artikelnummer: ATA-HPA046817
Artikelname: Anti-CLK3
Artikelnummer: ATA-HPA046817
Hersteller Artikelnummer: HPA046817
Alternativnummer: ATA-HPA046817-100,ATA-HPA046817-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: clk3
CDC-like kinase 3
Anti-CLK3
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 1198
UniProt: P49761
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSVEDDKE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CLK3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts and Leydig cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA046817-100ul
HPA046817-100ul
HPA046817-100ul