Anti-ST13
Artikelnummer:
ATA-HPA047116
- Bilder (6)
| Artikelname: | Anti-ST13 |
| Artikelnummer: | ATA-HPA047116 |
| Hersteller Artikelnummer: | HPA047116 |
| Alternativnummer: | ATA-HPA047116-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FAM10A1, HIP, HSPABP1, P48, SNC6 |
| suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) |
| Anti-ST13 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6767 |
| UniProt: | P50502 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | AIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPRAQKIAEHRRKYER |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ST13 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human urinary bladder shows moderate nuclear, cytoplasmic and membranous positivity in urothelial cells. |
|
|
Western blot analysis using Anti-ST13 antibody HPA047116 (A) shows similar pattern to independent antibody HPA046412 (B). |
|
|
Western blot analysis in human cell line RT-4. |
|
|
HPA047116-100ul |
|
|
HPA047116-100ul |
|
|
HPA047116-100ul |
Produktgarantie und fachkundiger Support
