Anti-PLA2G1B
Artikelnummer:
ATA-HPA047822
- Bilder (6)
| Artikelname: | Anti-PLA2G1B |
| Artikelnummer: | ATA-HPA047822 |
| Hersteller Artikelnummer: | HPA047822 |
| Alternativnummer: | ATA-HPA047822-100,ATA-HPA047822-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PLA2, PLA2A, PPLA2 |
| phospholipase A2, group IB (pancreas) |
| Anti-PLA2G1B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5319 |
| UniProt: | P04054 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PLA2G1B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human pancreas and skeletal muscle tissues using Anti-PLA2G1B antibody. Corresponding PLA2G1B RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human pancreas shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
HPA047822-100ul |
|
|
HPA047822-100ul |
|
|
HPA047822-100ul |
Produktgarantie und fachkundiger Support
