Anti-SERINC3
Artikelnummer:
ATA-HPA048116
- Bilder (6)
| Artikelname: | Anti-SERINC3 |
| Artikelnummer: | ATA-HPA048116 |
| Hersteller Artikelnummer: | HPA048116 |
| Alternativnummer: | ATA-HPA048116-100,ATA-HPA048116-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AIGP1, DIFF33, SBBI99, TDE, TDE1, TMS-1 |
| serine incorporator 3 |
| Anti-SERINC3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10955 |
| UniProt: | Q13530 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EMETYLKKIPGFCEGGFKIHEADINADKDCDVLVGYK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SERINC3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue |
|
|
HPA048116-100ul |
|
|
|
|
|
HPA048116-100ul |
|
|
HPA048116-100ul |
Produktgarantie und fachkundiger Support
