Anti-LZTFL1
Artikelnummer:
ATA-HPA048447
- Bilder (9)
| Artikelname: | Anti-LZTFL1 |
| Artikelnummer: | ATA-HPA048447 |
| Hersteller Artikelnummer: | HPA048447 |
| Alternativnummer: | ATA-HPA048447-100,ATA-HPA048447-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BBS17 |
| leucine zipper transcription factor-like 1 |
| Anti-LZTFL1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 54585 |
| UniProt: | Q9NQ48 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | AELGLNEHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKESRLVEDTFTIDEVSEVLNGLQAVVHSEVESELIN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LZTFL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-LZTFL1 antibody. Corresponding LZTFL1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver, lymph node, skeletal muscle and testis using Anti-LZTFL1 antibody HPA048447 (A) shows similar protein distribution across tissues to independent antibody HPA043466 (B). |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Immunohistochemical staining of human liver using Anti-LZTFL1 antibody HPA048447. |
|
|
Immunohistochemical staining of human lymph node using Anti-LZTFL1 antibody HPA048447. |
|
|
HPA048447-100ul |
|
|
HPA048447-100ul |
|
|
HPA048447-100ul |
Produktgarantie und fachkundiger Support
