Anti-PVALB
Artikelnummer:
ATA-HPA048536
- Bilder (9)
| Artikelname: | Anti-PVALB |
| Artikelnummer: | ATA-HPA048536 |
| Hersteller Artikelnummer: | HPA048536 |
| Alternativnummer: | ATA-HPA048536-100,ATA-HPA048536-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | D22S749 |
| parvalbumin |
| Anti-PVALB |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5816 |
| UniProt: | P20472 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PVALB |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm. |
|
|
Immunohistochemistry analysis in human parathyroid gland and liver tissues using Anti-PVALB antibody. Corresponding PVALB RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human parathyroid gland shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human Kidney tissue |
|
|
|
|
|
HPA048536-100ul |
|
|
HPA048536-100ul |
|
|
HPA048536-100ul |
Produktgarantie und fachkundiger Support
