Anti-TMEM27

Artikelnummer: ATA-HPA048543
Artikelname: Anti-TMEM27
Artikelnummer: ATA-HPA048543
Hersteller Artikelnummer: HPA048543
Alternativnummer: ATA-HPA048543-100,ATA-HPA048543-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: NX17
transmembrane protein 27
Anti-TMEM27
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 57393
UniProt: Q9HBJ8
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LVTAIHAELCQPGAENAFKVRLSIRTALGDKAYAWDTNEEYLFKAMVAFSMRKVPNREATEISHVLLCNVTQRVSFWFVVTDPSKNHTLPAVEVQSAIRMNKNRINNAFFLNDQTLE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TMEM27
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line HaCaT shows localization to endoplasmic reticulum & vesicles.
Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-TMEM27 antibody. Corresponding TMEM27 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney shows high expression.
Immunohistochemical staining of human lymph node shows low expression as expected.
HPA048543-100ul
HPA048543-100ul
HPA048543-100ul