Anti-MLANA
Artikelnummer:
ATA-HPA048662
- Bilder (8)
| Artikelname: | Anti-MLANA |
| Artikelnummer: | ATA-HPA048662 |
| Hersteller Artikelnummer: | HPA048662 |
| Alternativnummer: | ATA-HPA048662-100,ATA-HPA048662-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MART1 |
| melan-A |
| Anti-MLANA |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2315 |
| UniProt: | Q16655 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MLANA |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human skin and colon tissues using Anti-MLANA antibody. Corresponding MLANA RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skin shows high expression. |
|
|
Immunohistochemical staining of human colon shows low expression as expected. |
|
|
Western blot analysis in human cell lines SK-MEL-30 and PC-3 using Anti-MLANA antibody. Corresponding MLANA RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
HPA048662-100ul |
|
|
|
|
|
HPA048662-100ul |
|
|
HPA048662-100ul |
Produktgarantie und fachkundiger Support
