Anti-SUPT16H
Artikelnummer:
ATA-HPA049787
- Bilder (8)
| Artikelname: | Anti-SUPT16H |
| Artikelnummer: | ATA-HPA049787 |
| Hersteller Artikelnummer: | HPA049787 |
| Alternativnummer: | ATA-HPA049787-100,ATA-HPA049787-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CDC68, FACT, FACTP140, FLJ10857, FLJ14010, SPT16/CDC68 |
| suppressor of Ty 16 homolog (S. cerevisiae) |
| Anti-SUPT16H |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 11198 |
| UniProt: | Q9Y5B9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSY |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SUPT16H |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus. |
|
|
Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-SUPT16H antibody. Corresponding SUPT16H RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
HPA049787-100ul |
|
|
|
|
|
HPA049787-100ul |
|
|
HPA049787-100ul |
Produktgarantie und fachkundiger Support
