Anti-RRN3
Artikelnummer:
ATA-HPA049837
- Bilder (7)
| Artikelname: | Anti-RRN3 |
| Artikelnummer: | ATA-HPA049837 |
| Hersteller Artikelnummer: | HPA049837 |
| Alternativnummer: | ATA-HPA049837-100,ATA-HPA049837-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DKFZp566E104 |
| RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae) |
| Anti-RRN3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 54700 |
| UniProt: | Q9NYV6 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RRN3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli. |
|
|
Immunohistochemical staining of human cerebellum shows strong nucleolar positivity in Purkinje cells. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RRN3 antibody. Remaining relative intensity is presented. |
|
|
HPA049837 |
|
|
HPA049837-100ul |
|
|
HPA049837 |
|
|
HPA049837 |
Produktgarantie und fachkundiger Support
