Anti-EHD3
Artikelnummer:
ATA-HPA049986
- Bilder (8)
| Artikelname: | Anti-EHD3 |
| Artikelnummer: | ATA-HPA049986 |
| Hersteller Artikelnummer: | HPA049986 |
| Alternativnummer: | ATA-HPA049986-100,ATA-HPA049986-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PAST3 |
| EH-domain containing 3 |
| Anti-EHD3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 30845 |
| UniProt: | Q9NZN3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | EHD3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli. |
|
|
Immunohistochemical staining of human lymphoid tissues shows moderate positivity in reticular fibers in germinal center cells. |
|
|
Immunohistochemical staining of human liver shows moderate membranous positivity in hepatic sinusoid cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue Lane 6: Human tonsil tissue |
|
|
HPA049986-100ul |
|
|
HPA049986-100ul |
|
|
HPA049986-100ul |
Produktgarantie und fachkundiger Support
