Anti-KCTD16

Artikelnummer: ATA-HPA050154
Artikelname: Anti-KCTD16
Artikelnummer: ATA-HPA050154
Hersteller Artikelnummer: HPA050154
Alternativnummer: ATA-HPA050154-100,ATA-HPA050154-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA1317
potassium channel tetramerization domain containing 16
Anti-KCTD16
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 57528
UniProt: Q68DU8
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PQETVICGPVTRQTNIQTLDRPIKKGPVQLIQQSEMRRKSDLLRTLTSGSRESNMSSKKKAVKEKLS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: KCTD16
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and KCTD16 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412323).
HPA050154-100ul
HPA050154-100ul
HPA050154-100ul