Anti-TMEM38A

Artikelnummer: ATA-HPA050463
Artikelname: Anti-TMEM38A
Artikelnummer: ATA-HPA050463
Hersteller Artikelnummer: HPA050463
Alternativnummer: ATA-HPA050463-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MGC3169, TRIC-A
transmembrane protein 38A
Anti-TMEM38A
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 79041
UniProt: Q9H6F2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: THSHSSPFDALEGYICPVLFGSACGGDHHHDNHGGSHSGGGPGAQHSAMPAKSKEELSEGSRKK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TMEM38A
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human skeletal muscle and prostate tissues using Anti-TMEM38A antibody. Corresponding TMEM38A RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human prostate shows low expression as expected.
Immunohistochemical staining of human skeletal muscle shows high expression.
Western blot analysis in control (vector only transfected HEK293T lysate) and TMEM38A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411389).
HPA050463-100ul
HPA050463-100ul
HPA050463-100ul