Anti-FOXA1

Artikelnummer: ATA-HPA050505
Artikelname: Anti-FOXA1
Artikelnummer: ATA-HPA050505
Hersteller Artikelnummer: HPA050505
Alternativnummer: ATA-HPA050505-100,ATA-HPA050505-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HNF3A
forkhead box A1
Anti-FOXA1
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 3169
UniProt: P55317
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FOXA1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & nucleoli fibrillar center.
Immunohistochemistry analysis in human prostate and endometrium tissues using Anti-FOXA1 antibody. Corresponding FOXA1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human prostate shows high expression.
Immunohistochemical staining of human endometrium shows low expression as expected.
HPA050505-100ul
HPA050505-100ul
HPA050505-100ul