Anti-CD69
Artikelnummer:
ATA-HPA050525
- Bilder (7)
| Artikelname: | Anti-CD69 |
| Artikelnummer: | ATA-HPA050525 |
| Hersteller Artikelnummer: | HPA050525 |
| Alternativnummer: | ATA-HPA050525-100,ATA-HPA050525-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CLEC2C |
| CD69 molecule |
| Anti-CD69 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 969 |
| UniProt: | Q07108 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CD69 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human tonsil and pancreas tissues using HPA050525 antibody. Corresponding CD69 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human tonsil shows moderate membranous positivity mainly in germinal center cells. |
|
|
Immunohistochemical staining of human duodenum shows moderate membranous positivity in a subset of lymphoid cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine and endocrine glandular cells as expected. |
|
|
HPA050525-100ul |
|
|
HPA050525-100ul |
|
|
HPA050525-100ul |
Produktgarantie und fachkundiger Support
