Anti-POU1F1 ChIP certified
Artikelnummer:
ATA-HPA050624
- Bilder (8)
| Artikelname: | Anti-POU1F1 ChIP certified |
| Artikelnummer: | ATA-HPA050624 |
| Hersteller Artikelnummer: | HPA050624 |
| Alternativnummer: | ATA-HPA050624-100,ATA-HPA050624-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GHF-1, PIT1, POU1F1a |
| POU class 1 homeobox 1 |
| Anti-POU1F1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5449 |
| UniProt: | P28069 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | POU1F1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemical staining of human liver, pancreas, pituitary gland and tonsil using Anti-POU1F1 antibody HPA050624 (A) shows similar protein distribution across tissues to independent antibody HPA041646 (B). |
|
|
Immunohistochemical staining of human pituitary gland shows moderate to strong nuclear positivity in neuroendocrine cells in the anterior lobe. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human tonsil shows no positivity in non-germinal center cells as expected. |
|
|
HPA050624-100ul |
|
|
HPA050624-100ul |
|
|
HPA050624-100ul |
Produktgarantie und fachkundiger Support
