Anti-DNAJB5

Artikelnummer: ATA-HPA050794
Artikelname: Anti-DNAJB5
Artikelnummer: ATA-HPA050794
Hersteller Artikelnummer: HPA050794
Alternativnummer: ATA-HPA050794-100,ATA-HPA050794-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Molekularbiologie
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Hsc40
DnaJ (Hsp40) homolog, subfamily B, member 5
Anti-DNAJB5
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 25822
UniProt: O75953
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: IDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLPCS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DNAJB5
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line RH-30 shows localization to nucleus & cytosol.
HPA050794-100ul