Anti-CAMTA2

Artikelnummer: ATA-HPA051147
Artikelname: Anti-CAMTA2
Artikelnummer: ATA-HPA051147
Hersteller Artikelnummer: HPA051147
Alternativnummer: ATA-HPA051147-100,ATA-HPA051147-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA0909
calmodulin binding transcription activator 2
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 23125
UniProt: O94983
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EKRMAEIAAAGQVPCQGPDAPPVQDEGQGPGFEARVVVLVESMIPRSTWKGPERLAHGS
Target-Kategorie: CAMTA2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
HPA051147-100ul