Anti-PYHIN1

Artikelnummer: ATA-HPA051224
Artikelname: Anti-PYHIN1
Artikelnummer: ATA-HPA051224
Hersteller Artikelnummer: HPA051224
Alternativnummer: ATA-HPA051224-100,ATA-HPA051224-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: IFIX, MGC23885
pyrin and HIN domain family, member 1
Anti-PYHIN1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 149628
UniProt: Q6K0P9
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: IESIPVKGIIPSKKTKQKEVYPATPACTPSNRLTAKGAEETLGPQKRKKPSEEETGTKRSKMSKEQTRPSCS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PYHIN1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human tonsil and skin tissues using Anti-PYHIN1 antibody. Corresponding PYHIN1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human tonsil shows high expression.
Immunohistochemical staining of human skin shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA051224-100ul
HPA051224-100ul
HPA051224-100ul