Anti-SH3BGRL
Artikelnummer:
ATA-HPA051248
- Bilder (7)
| Artikelname: | Anti-SH3BGRL |
| Artikelnummer: | ATA-HPA051248 |
| Hersteller Artikelnummer: | HPA051248 |
| Alternativnummer: | ATA-HPA051248-100,ATA-HPA051248-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MGC117402 |
| SH3 domain binding glutamate-rich protein like |
| Anti-SH3BGRL |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6451 |
| UniProt: | O75368 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SH3BGRL |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to vesicles. |
|
|
Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in white pulp. |
|
|
Western blot analysis in human cell lines SK-MEL-30 and A-431 using Anti-SH3BGRL antibody. Corresponding SH3BGRL RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue Lane 6: Human tonsil tissue |
|
|
HPA051248-100ul |
|
|
HPA051248-100ul |
|
|
HPA051248-100ul |
Produktgarantie und fachkundiger Support
