Anti-SLC34A1
Artikelnummer:
ATA-HPA051255
- Bilder (8)
| Artikelname: | Anti-SLC34A1 |
| Artikelnummer: | ATA-HPA051255 |
| Hersteller Artikelnummer: | HPA051255 |
| Alternativnummer: | ATA-HPA051255-100,ATA-HPA051255-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NAPI-3, NPT2, NPTIIa, SLC11, SLC17A2 |
| solute carrier family 34 (type II sodium/phosphate contransporter), member 1 |
| Anti-SLC34A1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6569 |
| UniProt: | Q06495 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PLPVPGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEHTCPCGEVLERHEPLPAKLALEEEQKPESRLVPKLRQA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC34A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line HEL shows localization to nuclear speckles, plasma membrane & mitotic spindle. |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules. |
|
|
Western blot analysis in human kidney tissue. |
|
|
|
|
|
|
|
|
HPA051255-100ul |
|
|
HPA051255-100ul |
|
|
HPA051255-100ul |
Produktgarantie und fachkundiger Support
