Anti-SLC26A9
Artikelnummer:
ATA-HPA051485
- Bilder (8)
| Artikelname: | Anti-SLC26A9 |
| Artikelnummer: | ATA-HPA051485 |
| Hersteller Artikelnummer: | HPA051485 |
| Alternativnummer: | ATA-HPA051485-100,ATA-HPA051485-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SLC26A9 |
| solute carrier family 26 (anion exchanger), member 9 |
| Anti-SLC26A9 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 115019 |
| UniProt: | Q7LBE3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRC |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC26A9 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A549 shows localization to cell junctions. |
|
|
Immunohistochemistry analysis in human stomach and pancreas tissues using Anti-SLC26A9 antibody. Corresponding SLC26A9 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human stomach shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
HPA051485-100ul |
|
|
|
|
|
HPA051485-100ul |
|
|
HPA051485-100ul |
Produktgarantie und fachkundiger Support
